Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein lifeguard 1 (Grina)

This Recombinant Rat Protein lifeguard 1 (Grina) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit

UniProt

Q6P6R0

Expression Region

1-348

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHEKSFLVSGDSYPPPNPGYPVGPQAPMPPYVQPPYPGAPYPQAAFQPSPYGQPGYPHG PGPYPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYY DNQDFPSVNWDKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRANVWTYYVS YAIFFISLIVLSCCGDFRRKHPWNLVALSILTISLSYMVGMIASFYNTEAVIMAVGITTA VCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCF LAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF568 conjugate, 0.1mg/mL
BNC680264-500 1x 500 µL

Human Kappa Light Chain (KLC264), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF647 conjugate, 0.1mg/mL
BNC471239-500 1x 500 µL

Napsin-A (NAPSA/1239), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (PMEL/783), CF740 conjugate, 0.1mg/mL
BNC740783-500 1x 500 µL

Pmel17 / gp100 / SILV (PMEL/783), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF568 conjugate, 0.1mg/mL
BNC681076-100 1x 100 µL

Cytokeratin, HMW (KRTH/1076), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF640R conjugate, 0.1mg/mL
BNC400287-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details