Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 9 (TAAR9)

This Recombinant Human Trace amine-associated receptor 9 (TAAR9) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 9, TaR-9, Trace amine receptor 9, Trace amine receptor 3, TaR-3

UniProt

Q96RI9

Expression Region

1-348

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNNFSQAEAVELCYKNVNESCIKTPYSPGPRSILYAVLGFGAVLAAFGNLLVMIAILHF KQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTCFDTSFCFASL FHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEEL VVALTCVGGCQAPLNQNWVLLCFLLFFIPNVAMVFIYSKIFLVAKHQARKIESTASQAQS SSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWCV YYNSAMNPLIYAFFYQWFGKAIKLIVSGKVLRTDSSTTNLFSEEVETD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coronarin D methyl ether
379909 5 mg

Coronarin D methyl ether

Sign In for Pricing
View Details
GLS Protein Vector (Mouse) (pPM-C-His)
PV182357 500 ng

GLS Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DKK2 polyclonal antibody
BS76003-01 50 µL

DKK2 polyclonal antibody

Sign In for Pricing
View Details
DKK2 polyclonal antibody
BS76003-02 100 µL

DKK2 polyclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Rmi1 shRNA (UAS) - Lentiviral mouse Rmi1 shRNA (UAS) (100)
GTR15158226 1 Vial

Lentiviral mouse Rmi1 shRNA (UAS) - Lentiviral mouse Rmi1 shRNA (UAS) (100)

Sign In for Pricing
View Details
NBEAL1 shRNA Plasmid (m)
sc-149846-SH 20 µg

NBEAL1 shRNA Plasmid (m)

Sign In for Pricing
View Details