Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trace amine-associated receptor 9 (TAAR9)

This Recombinant Human Trace amine-associated receptor 9 (TAAR9) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 9, TaR-9, Trace amine receptor 9, Trace amine receptor 3, TaR-3

UniProt

Q96RI9

Expression Region

1-348

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNNFSQAEAVELCYKNVNESCIKTPYSPGPRSILYAVLGFGAVLAAFGNLLVMIAILHF KQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTCFDTSFCFASL FHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEEL VVALTCVGGCQAPLNQNWVLLCFLLFFIPNVAMVFIYSKIFLVAKHQARKIESTASQAQS SSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWCV YYNSAMNPLIYAFFYQWFGKAIKLIVSGKVLRTDSSTTNLFSEEVETD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit
MBS7232886-01 48 Well

Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit
MBS7232886-02 96 Well

Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit
MBS7232886-03 5x 96 Well

Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit
MBS7232886-04 10x 96 Well

Guinea pig 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Rat Nbr1 Pre-designed siRNA Set B
SI209063B 1 Each

Rat Nbr1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
H-Tle-OMe.HCl
A6716-100000 100 g

H-Tle-OMe.HCl

Sign In for Pricing
View Details