Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T4 (OR2T4)

This Recombinant Human Olfactory receptor 2T4 (OR2T4) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Olfactory receptor 2T4, Olfactory receptor OR1-60

UniProt

Q8NH00

Expression Region

1-348

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNITWMASHTGWSDFILMGLFRQSKHPMANITWMANHTGWSDFILLGLFRQSKHPALLC VVIFVVFLMALSGNAVLILLIHCDAHLHTPMYFFISQLSLMDMAYISVTVPKMLLDQVMG VNKISAPECGMQMFFYVTLAGSEFFLLATMAYDRYVAICHPLRYPVLMNHRVCLFLSSGC WFLGSVDGFTFTPITMTFPFRGSREIHHFFCEVPAVLNLSCSDTSLYEIFMYLCCVLMLL IPVVIISSSYLLILLTIHGMNSAEGRKKAFATCSSHLTVVILFYGAAIYTYMLPSSYHTP EKDMMVSVFYTILTPVVNPLIYSLRNKDVMGALKKMLTVEPAFQKAME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F5 Antibody, FITC conjugated
CSB-PA007929HC01HU-01 50 µg

F5 Antibody, FITC conjugated

Sign In for Pricing
View Details
F5 Antibody, FITC conjugated
CSB-PA007929HC01HU-02 100 µg

F5 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Leptonychotes weddelli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
orb2935235-01 20 µg

Recombinant Leptonychotes weddelli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Sign In for Pricing
View Details
Recombinant Leptonychotes weddelli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
orb2935235-02 100 µg

Recombinant Leptonychotes weddelli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Sign In for Pricing
View Details
anti-hIFNr (3A2)
LF-MA0403 100 ul

anti-hIFNr (3A2)

Sign In for Pricing
View Details
Mmu-miR-7672-5p antagomir
HY-RI04095A-01 5 nmol

Mmu-miR-7672-5p antagomir

Sign In for Pricing
View Details