Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Organic solute transporter alpha-like protein W01D2.5 (W01D2.5)

This Recombinant Organic solute transporter alpha-like protein W01D2.5 (W01D2.5) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Organic solute transporter alpha-like protein W01D2.5

UniProt

Q9XU63

Expression Region

1-348

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKEHGAMRSVLNLIGSVMLPQDTSNCSDRHDTPSAPEFLSHLQPFQTVLLSIASFSTTI VLCLSLIHWFYVYKYVSIEKRRNKLYWLIAVFPVACSCSFIAMCVPRTAVILTCIGVLYY LMCLFVIVSLARHLFGGRESFSTCLQYDDRPIDFRSPPFCCIIPKLPTARSTEKNIRRLE WCVLQAPIVRSIIIFLDVVAVAEMREDATPYIRYSDMASLCSLLLAIFGVHTLARVTSNK LSAYCFMSMFRLVDISLLFFSAQQPMIFQNVLLRFNLISCGPLLNAQENAYFVCNFIITC EMLLLSVLATWLLAPRHNAMFDAYRPSMALSETTASLNETEQSMILDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL
BNC401228-100 1x 100 µL

CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL
BNC680495-100 1x 100 µL

SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details