Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhodopsin (Rho)

This Recombinant Mouse Rhodopsin (Rho) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P15409

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI YNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Rabbit Polyclonal Antibody
AP02585PU-N 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse 2010310C07Rik activation kit by CRISPRa
GA209118 1 Kit

Mouse 2010310C07Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II,  30nm
GM-16-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II, 30nm

Sign In for Pricing
View Details
ID1 Human Gene Knockout Kit (CRISPR)
KN402061 1 Kit

ID1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS645690 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
2-[(4-Fluorobenzyl)amino]ethanol (>90%)
TRC-B434993-500MG 500 mg

2-[(4-Fluorobenzyl)amino]ethanol (>90%)

Sign In for Pricing
View Details