Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhodopsin (Rho)

This Recombinant Mouse Rhodopsin (Rho) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P15409

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI YNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kat2a activation kit by CRISPRa
GA201569 1 Kit

Mouse Kat2a activation kit by CRISPRa

Sign In for Pricing
View Details
CD63 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]
TA803392BM 100 µL

CD63 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]

Sign In for Pricing
View Details
Human H10 (H1F0) activation kit by CRISPRa
GA102043 1 Kit

Human H10 (H1F0) activation kit by CRISPRa

Sign In for Pricing
View Details
Cbs Mouse Gene Knockout Kit (CRISPR)
KN502607 1 Kit

Cbs Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF740 conjugate, 0.1mg/mL
BNC741009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), 0.2mg/mL
BNUB1922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), 0.2mg/mL

Sign In for Pricing
View Details