Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 3A4 (OR3A4P)

This Recombinant Human Putative olfactory receptor 3A4 (OR3A4P) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Putative olfactory receptor 3A4, Olfactory receptor 17-24, OR17-24, Olfactory receptor 3A5

UniProt

P47883

Expression Region

1-348

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLGNSGNDSVVTKFVLLGLTETAALQPILFVIFLLAYVTTIGGTLSILAAILMETKLHS PMYFFLGNLSLPDVGCVSVTVPAMLSHFISNDRSIPYKACLSELFFFHLLAGADCFLLTI MAYDRYLAICQSLTYSSRMSWGIQQALVGMSCVFSFTNALTQTVALSPLNFCGPNVINHF YCDLPQPFQLSCSSVHLNGQLLFVAAAFMGVAPLVLITVSYAHVAAAVLRIRSAEGRKKA FSTCSSHLTVVGIFYGTGVFSYTRLGSVESSDKDKGIGILNTVISPMLNPLIYWTSLLDV GCISHCSSDAGVSPGPPVQSSLCCLQFTALLSPPPGWGGLSPLNSHGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E1 Human Gene Knockout Kit (CRISPR)
KN207015 1 Kit

NR2E1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 Recombinant Mouse Monoclonal Antibody [3-G3-D8-R]
HA601065 100 µL

Cytokeratin 7 Recombinant Mouse Monoclonal Antibody [3-G3-D8-R]

Sign In for Pricing
View Details
Lamin B Receptor (LBR) (NM_002296) Human Over-expression Lysate
LY419408 100 µg

Lamin B Receptor (LBR) (NM_002296) Human Over-expression Lysate

Sign In for Pricing
View Details
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D5]
TA506841AM 100 µL

p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D5]

Sign In for Pricing
View Details
Di-n-octyldichlorotin
TRC-D481755-25G 25 g

Di-n-octyldichlorotin

Sign In for Pricing
View Details
Uncoated Rat IgG2c (Immunoglobulin G2c) ELISA Kit
E-UNEL-R0073-01 5x 96 Tests

Uncoated Rat IgG2c (Immunoglobulin G2c) ELISA Kit

Sign In for Pricing
View Details