Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Rhodopsin (RHO)

This Recombinant Rabbit Rhodopsin (RHO) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P49912

Expression Region

1-348

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPDFYIPMSNQTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTTTLYTSLHGYFVFGPTGCNVEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWIMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPLIIIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSSSI YNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATASKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E2]
TA502160BM 100 µL

XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E2]

Sign In for Pricing
View Details
TXNRD3 Human Gene Knockout Kit (CRISPR)
KN430340 1 Kit

TXNRD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Nuclear Factor Kappa B2 (NFkB2) ELISA Kit
RDR-NFkB2-Mu-01 96 Tests

Mouse Nuclear Factor Kappa B2 (NFkB2) ELISA Kit

Sign In for Pricing
View Details
Mouse Nuclear Factor Kappa B2 (NFkB2) ELISA Kit
RDR-NFkB2-Mu-02 48 Tests

Mouse Nuclear Factor Kappa B2 (NFkB2) ELISA Kit

Sign In for Pricing
View Details
Ethyl 2-Fluoropropionate
TRC-E917965-5G 5 g

Ethyl 2-Fluoropropionate

Sign In for Pricing
View Details
IL7R alpha (IL7R) (NM_002185) Human Over-expression Lysate
LY400798 100 µg

IL7R alpha (IL7R) (NM_002185) Human Over-expression Lysate

Sign In for Pricing
View Details