Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galanin receptor type 1 (Galr1)

This Recombinant Mouse Galanin receptor type 1 (Galr1) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Galanin receptor type 1, GAL1-R, GALR-1

UniProt

P56479

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLAR SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYHQRLFHRD SNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEAS KKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPI IYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNCTHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGR3 (NM_176813) Human Recombinant Protein
TP720456M 50 µg

AGR3 (NM_176813) Human Recombinant Protein

Sign In for Pricing
View Details
P14ARF (4C6/4), CF740 conjugate, 0.1mg/mL
BNC742088-100 1x 100 µL

P14ARF (4C6/4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) (3rd Extracell. Dom.) Rat Monoclonal Antibody [Clone ID: BEP-5D8]
AM26786PU-N 100 µg

VEGF Receptor 2 (KDR) (3rd Extracell. Dom.) Rat Monoclonal Antibody [Clone ID: BEP-5D8]

Sign In for Pricing
View Details
Anti-Mouse PD-L1 (10F.9G2) In Vivo Antibody - Low Endotoxin
ICH1086-5mg 5 mg

Anti-Mouse PD-L1 (10F.9G2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
SERTAD1 Rabbit Polyclonal Antibody
TA371502 100 µL

SERTAD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATA3 Mouse Monoclonal Antibody [Clone ID: OTI5C11]
CF809094 100 µg

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI5C11]

Sign In for Pricing
View Details