Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galanin receptor type 1 (Galr1)

This Recombinant Mouse Galanin receptor type 1 (Galr1) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Galanin receptor type 1, GAL1-R, GALR-1

UniProt

P56479

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLAR SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYHQRLFHRD SNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEAS KKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPI IYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNCTHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR559634 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA362659 100 µL

Rad51L1 (RAD51B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®430 Tyramide
#96053 1x 500 µg

CF®430 Tyramide

Sign In for Pricing
View Details
NRBF2 (N-term) Rabbit Polyclonal Antibody
AP46001PU-N 100 µL

NRBF2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 1mg/mL
BNUM1819-50 1x 50 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), 0.2mg/mL
BNUB0743-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), 0.2mg/mL

Sign In for Pricing
View Details