Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galanin receptor type 1 (Galr1)

This Recombinant Mouse Galanin receptor type 1 (Galr1) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Galanin receptor type 1, GAL1-R, GALR-1

UniProt

P56479

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLAR SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYHQRLFHRD SNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEAS KKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPI IYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNCTHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ileum
CR559322 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
IGFBP1 (NM_000596) Human Recombinant Protein
TP309268M 100 µg

IGFBP1 (NM_000596) Human Recombinant Protein

Sign In for Pricing
View Details
OptiWell™ DeepWell Plates
D3384-03S 50 Units/Case

OptiWell™ DeepWell Plates

Sign In for Pricing
View Details
Fig4 Mouse Monoclonal Antibody [Clone ID: N202/7]
75-201 100 µL

Fig4 Mouse Monoclonal Antibody [Clone ID: N202/7]

Sign In for Pricing
View Details
Cinnamylamine Hydrochloride
TRC-C442090-1G 1 g

Cinnamylamine Hydrochloride

Sign In for Pricing
View Details
HLA-Pan (MHC II) (HLA-Pan/2967R), CF405S conjugate, 0.1mg/mL
BNC042967-100 1x 100 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details