Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Rhodopsin (RHO)

This Recombinant Sheep Rhodopsin (RHO) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P02700

Expression Region

1-348

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP QGMQCSCGALYFTLKPEINNESFVIYMFVVHFSIPLIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKSSSV YNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ mmu-miR-7221-3p miRNA Agomir/Antagomir
AM2617 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-7221-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Rabbit Anti-Human TLR8 pAb
PA8515-01 50 μL

Rabbit Anti-Human TLR8 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TLR8 pAb
PA8515-02 100 μL

Rabbit Anti-Human TLR8 pAb

Sign In for Pricing
View Details
ODZ1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11919R-BF405 100 µL

ODZ1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Sgca (NM_009161) Mouse Tagged Lenti ORF Clone
MR224511L4 10 µg

Sgca (NM_009161) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GAPT Adenovirus (Rat)
21309056 1.0 mL

GAPT Adenovirus (Rat)

Sign In for Pricing
View Details