Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tursiops truncatus Rhodopsin (RHO)

This Recombinant Tursiops truncatus Rhodopsin (RHO) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O62798

Expression Region

1-348

Origin

Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGLNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSVLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVANLFMVFGGFTTTLYTSLHAYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWIMAMACAAAPLVGWSRYIP EGMQCSCGIDYYTSRQEVNNESFVIYMFVVHFTIPLVIIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVAFLICWVPYASVAFYIFTHQGSDFGPIFMTIPSFFAKSSSI YNPVIYIMMNKQFRNCMLTTLCCGRNPLGDDEASTTASKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF740 conjugate, 0.1mg/mL
BNC742312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF488A conjugate, 0.1mg/mL
BNC882424-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details