Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Rhodopsin (Rho)

This Recombinant Rat Rhodopsin (Rho) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P51489

Expression Region

1-348

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSNFGPIFMTLPAFFAKTASI YNPIIYIMMNKQFRNCMLTSLCCGKNPLGDDEASATASKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp8b3 Mouse Gene Knockout Kit (CRISPR)
KN501835 1 Kit

Atp8b3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ST3GAL2 Human Gene Knockout Kit (CRISPR)
KN207761LP 1 Kit

ST3GAL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DPM1 activation kit by CRISPRa
GA105857 1 Kit

Human DPM1 activation kit by CRISPRa

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), 0.2mg/mL
BNUB2796-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), 0.2mg/mL

Sign In for Pricing
View Details
HOMER2 (NM_199332) Human Recombinant Protein
TP318155L 1 mg

HOMER2 (NM_199332) Human Recombinant Protein

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), 0.2mg/mL
BNUB1553-100 1x 100 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), 0.2mg/mL

Sign In for Pricing
View Details