Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Pheromone P-factor receptor (mam2)

This Recombinant Schizosaccharomyces pombe Pheromone P-factor receptor (mam2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Pheromone P-factor receptor

UniProt

Q00619

Expression Region

1-348

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRQPWWKDFTIPDASAIIHQNITIVSIVGEIEVPVSTIDAYERDRLLTGMTLSAQLALGV LTILMVCLLSSSEKRKHPVFVFNSASIVAMCLRAILNIVTICSNSYSILVNYGFILNMVH MYVHVFNILILLLAPVIIFTAEMSMMIQVRIICAHDRKTQRIMTVISACLTVLVLAFWIT NMCQQIQYLLWLTPLSSKTIVGYSWPYFIAKILFAFSIIFHSGVFSYKLFRAILIRKKIG QFPFGPMQCILVISCQCLIVPATFTIIDSFIHTYDGFSSMTQCLLIISLPLSSLWASSTA LKLQSMKTSSAQGETTEVSIRVDRTFDIKHTPSDDYSISDESETKKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC679154 3'UTR GFP Stable Cell Line
TU260417 1.0 mL

LOC679154 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
C6orf192 (SLC18B1) Human shRNA Plasmid Kit (Locus ID 116843)
TR305802 1 Kit

C6orf192 (SLC18B1) Human shRNA Plasmid Kit (Locus ID 116843)

Sign In for Pricing
View Details
STARD4 Rabbit Polyclonal Antibody
orb155300 100 µg

STARD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Protein LSM14 homolog A, LSM14A ELISA KIT
ELI-48072b 96 Tests

Bovine Protein LSM14 homolog A, LSM14A ELISA KIT

Sign In for Pricing
View Details
Gk5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4540307 1.0 µg DNA

Gk5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
2310050C09Rik (NM_025621) Mouse Tagged ORF Clone Lentiviral Particle
MR213070L4V 200 µL

2310050C09Rik (NM_025621) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details