Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Pheromone P-factor receptor (mam2)

This Recombinant Schizosaccharomyces pombe Pheromone P-factor receptor (mam2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Pheromone P-factor receptor

UniProt

Q00619

Expression Region

1-348

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRQPWWKDFTIPDASAIIHQNITIVSIVGEIEVPVSTIDAYERDRLLTGMTLSAQLALGV LTILMVCLLSSSEKRKHPVFVFNSASIVAMCLRAILNIVTICSNSYSILVNYGFILNMVH MYVHVFNILILLLAPVIIFTAEMSMMIQVRIICAHDRKTQRIMTVISACLTVLVLAFWIT NMCQQIQYLLWLTPLSSKTIVGYSWPYFIAKILFAFSIIFHSGVFSYKLFRAILIRKKIG QFPFGPMQCILVISCQCLIVPATFTIIDSFIHTYDGFSSMTQCLLIISLPLSSLWASSTA LKLQSMKTSSAQGETTEVSIRVDRTFDIKHTPSDDYSISDESETKKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF Receptor 3 Antibody
RQ4081 100 µg

VEGF Receptor 3 Antibody

Sign In for Pricing
View Details
FUNDC2 Antibody - N-terminal region
ARP67514_P050-25UL 25 µL

FUNDC2 Antibody - N-terminal region

Sign In for Pricing
View Details
DNAH1 Polyclonal Antibody, APC Conjugated
bs-14359R-APC 100 µL

DNAH1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Finntip 1000 100-1000ul 1000 Per bag
PIP3622 1000 / PCK

Finntip 1000 100-1000ul 1000 Per bag

Sign In for Pricing
View Details
Gas8 (E-11) : m-IgG Fc BP-HRP Bundle
sc-538267 1 Kit

Gas8 (E-11) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Human EG-VEGF/PK1 Rabbit mAb
A19268-01 100 μL

Human EG-VEGF/PK1 Rabbit mAb

Sign In for Pricing
View Details