Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Columba livia Pinopsin

This Recombinant Columba livia Pinopsin spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Pinopsin, Pineal gland-specific opsin, P-opsin, Pineal opsin

UniProt

P51476

Expression Region

1-349

Origin

Columba livia (Domestic pigeon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTNSPQEPPHTSTPGPFDGPQWPHQAPRGMYLSVAVLMGIVVISASVVNGLVIVVSIR YKKLRSPLNYILVNLAMADLLVTLCGSSVSFSNNINGFFVFGKRLCELEGFMVSLTGIVG LWSLAILALERYVVVCRPLGDFRFQHRHAVTGCAFTWVWSLLWTTPPLLGWSSYVPEGLR TSCGPNWYTGGSNNNSYILTLFVTCFVMPLSLILFSYANLLMTLRAAAAQQQESDTTQQA ERQVTRMVVAMVMAFLICWLPYTTFALVVATNKDIAIQPALASLPSYFSKTATVYNPIIY VFMNKQFQSCLLKMLCCGHHPRGTGRTAPAAPASPTDGLRNKVTPSHPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL
BNC880823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details