Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Green-sensitive opsin-3 (opn1mw3)

This Recombinant Danio rerio Green-sensitive opsin-3 (opn1mw3) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Green-sensitive opsin-3, Green cone photoreceptor pigment 3, Opsin RH2-3, Opsin-1, medium-wave-sensitive 3

UniProt

Q8AYM7

Expression Region

1-349

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGNNFYIPMSNRTGLVRSPYEYPQYYLAEPWQFKLLAVYMFFLMCFGFPINGLTLV VTAQHKKLRQPLNFILVNLAVAGTIMVCFGFTVTFYTAINGYFVLGPTGCAIEGFMATLG GQISLWSLVVLAIERYIVVCKPMGSFKFSSNHAFAGIGFTWIMALSCAAPPLVGWSRYIP EGMQCSCGPDYYTLNPDYNNESYVLYMFCCHFIFPVTTIFFTYGRLVCTVKAAAAQQQES ESTQKAEREVTRMVILMVLGFLVAWTPYASVAAWIFFNRGAAFSAQFMAVPAFFSKSSSI FNPIIYVLLNKQFRNCMLTTLFCGKNPLGDDESSTVSTSKTEVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF568 conjugate, 0.1mg/mL
BNC682597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF740 conjugate, 0.1mg/mL
BNC742889-500 1x 500 µL

Secretory Component / ECM1 (ECM1/2889R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF640R conjugate, 0.1mg/mL
BNC401790-500 1x 500 µL

CD79a (B-Cell Marker) (IGA/1790R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details