Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 21 (Gpr21)

This Recombinant Mouse Probable G-protein coupled receptor 21 (Gpr21) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 21

UniProt

Q8BX79

Expression Region

1-349

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTWDGNQSSHPFCLLALGYLETVRFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLN HHSTSYFIQTMAYADLLVGVSCLVPSLSLLYYPLPIEEAMTCQVFGFVVSVLKSISMASL ACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQW CAESWHTNSYFTLFIVMMLYAPAALIVCFTYFNIFRICQQHTKEISERQARFSSQNGETG EPQTCPDKRYAMVLFRITSVFYVLWLPYIIYFLLESSTGCSSRLASFLTTWLAISNSFCN CIIYSLSNSVFQRGLKGLSGSLCTSCASHTTAKDPYTVRCKGPPNGSHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Keratin 20 Antibody / CK20 / Cytokeratin 20
orb1151515-01 20 µg

Recombinant Keratin 20 Antibody / CK20 / Cytokeratin 20

Sign In for Pricing
View Details
Recombinant Keratin 20 Antibody / CK20 / Cytokeratin 20
orb1151515-02 100 µg

Recombinant Keratin 20 Antibody / CK20 / Cytokeratin 20

Sign In for Pricing
View Details
Recombinant Rat Erbb4 Protein, Fc-tagged, FITC conjugated
Erbb4-8720RF 20 μg- 50 μg- 100 μg

Recombinant Rat Erbb4 Protein, Fc-tagged, FITC conjugated

Sign In for Pricing
View Details
Chicken Transcription factor GATA-5, GATA5 ELISA KIT
E0122Ch-01 48 Well

Chicken Transcription factor GATA-5, GATA5 ELISA KIT

Sign In for Pricing
View Details
Chicken Transcription factor GATA-5, GATA5 ELISA KIT
E0122Ch-02 96 Well

Chicken Transcription factor GATA-5, GATA5 ELISA KIT

Sign In for Pricing
View Details
Chicken Transcription factor GATA-5, GATA5 ELISA KIT
E0122Ch-03 5x 96 Tests

Chicken Transcription factor GATA-5, GATA5 ELISA KIT

Sign In for Pricing
View Details