Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 21 (Gpr21)

This Recombinant Mouse Probable G-protein coupled receptor 21 (Gpr21) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 21

UniProt

Q8BX79

Expression Region

1-349

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTWDGNQSSHPFCLLALGYLETVRFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLN HHSTSYFIQTMAYADLLVGVSCLVPSLSLLYYPLPIEEAMTCQVFGFVVSVLKSISMASL ACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQW CAESWHTNSYFTLFIVMMLYAPAALIVCFTYFNIFRICQQHTKEISERQARFSSQNGETG EPQTCPDKRYAMVLFRITSVFYVLWLPYIIYFLLESSTGCSSRLASFLTTWLAISNSFCN CIIYSLSNSVFQRGLKGLSGSLCTSCASHTTAKDPYTVRCKGPPNGSHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS-E Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-9516R-APC-Cy5.5 100 µL

ALAS-E Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
SIGLEC10/SLG2 Rabbit Polyclonal Antibody
orb2952126-01 50 µg

SIGLEC10/SLG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIGLEC10/SLG2 Rabbit Polyclonal Antibody
orb2952126-02 100 µg

SIGLEC10/SLG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. Triosephosphate isomerase (tpiA)
MBS1081240-01 0.05 mg (E-Coli)

Recombinant Mycobacterium sp. Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. Triosephosphate isomerase (tpiA)
MBS1081240-02 0.05 mg (Yeast)

Recombinant Mycobacterium sp. Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. Triosephosphate isomerase (tpiA)
MBS1081240-03 0.2 mg (E-Coli)

Recombinant Mycobacterium sp. Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details