Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Green-sensitive opsin-1 (opn1mw1)

This Recombinant Danio rerio Green-sensitive opsin-1 (opn1mw1) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Green-sensitive opsin-1, Green cone photoreceptor pigment 1, Opsin RH2-1, Opsin-1, medium-wave-sensitive 1

UniProt

Q9W6A5

Expression Region

1-349

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGSNFYIPMSNRTGLVRSPYDYTQYYLAEPWKFKALAFYMFLLIIFGFPINVLTLV VTAQHKKLRQPLNYILVNLAFAGTIMVIFGFTVSFYCSLVGYMALGPLGCVMEGFFATLG GQVALWSLVVLAIERYIVVCKPMGSFKFSANHAMAGIAFTWFMACSCAVPPLFGWSRYLP EGMQTSCGPDYYTLNPEYNNESYVMYMFSCHFCIPVTTIFFTYGSLVCTVKAAAAQQQES ESTQKAEREVTRMVILMVLGFLFAWVPYASFAAWIFFNRGAAFSAQAMAVPAFFSKTSAV FNPIIYVLLNKQFRSCMLNTLFCGKSPLGDDESSSVSTSKTEVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF488A conjugate, 0.1mg/mL
BNC881748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details