Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus N-formyl peptide receptor 3 (FPR3)

This Recombinant Pongo pygmaeus N-formyl peptide receptor 3 (FPR3) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

N-formyl peptide receptor 3, FMLP-related receptor II, FMLP-R-II, Formyl peptide receptor-like 2

UniProt

P79237

Expression Region

1-349

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METNFSIPLNESEEVLPEPAGHTVLWIFSLLVHGVTFIFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFRMVSVAMREKWPFGTFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMMGLWILAIVLTLPNFIFWTTISTKNGDTYCIFNF PFWGDTAVERLNAFITMGKVFLILHFIIGFSMPMSIITVCYGIIAAKIHRNHMIKSSSPL RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLLNPTSSLAFFNSCLNPI LYVFLGSNFQERLIRSLPTSLERALTEVPDSAQTSNTHTNSASPPEETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF568 conjugate, 0.1mg/mL
BNC682603-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details