Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conger conger Blue-sensitive opsin

This Recombinant Conger conger Blue-sensitive opsin spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

O13227

Expression Region

1-350

Origin

Conger conger (Conger eel)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPMSNATGVVRSPFEYPQYYLAEPWAFSILAAYMFFLIITGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVFGETGCNLEGYFATLG GEISLWSLVVLAIERWVVVCKPISNFRFGENHAIMGLTLTWVMANACAMPPLFGWSRYIP EGLQCSCGIDYYTLKPEVNNESFVIYMFLVHFTIPLTIISFCYGRLVCAVKEAAAQQQES ETTQRAEREVTRMVVIMVISFLVCWIPYASVAWYIFTHQGSTFGPIFMTVPSFFAKSSSI YNPMIYICMNKQFRNCMITTLFCGKNPFEGEEEGSTTKTEASAVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ACOT7L antibody
PAab00094 100 µg

Anti-ACOT7L antibody

Sign In for Pricing
View Details
Glycerol kinase 2 (GK2) (Biotin)
317530-01 50 µg

Glycerol kinase 2 (GK2) (Biotin)

Sign In for Pricing
View Details
Glycerol kinase 2 (GK2) (Biotin)
317530-02 100 µg

Glycerol kinase 2 (GK2) (Biotin)

Sign In for Pricing
View Details
Dapagliflozin Impurity 203
RM-D160903-01 10 mg

Dapagliflozin Impurity 203

Sign In for Pricing
View Details
Dapagliflozin Impurity 203
RM-D160903-02 25 mg

Dapagliflozin Impurity 203

Sign In for Pricing
View Details
Dapagliflozin Impurity 203
RM-D160903-03 50 mg

Dapagliflozin Impurity 203

Sign In for Pricing
View Details