Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conger conger Blue-sensitive opsin

This Recombinant Conger conger Blue-sensitive opsin spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

O13227

Expression Region

1-350

Origin

Conger conger (Conger eel)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPMSNATGVVRSPFEYPQYYLAEPWAFSILAAYMFFLIITGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVFGETGCNLEGYFATLG GEISLWSLVVLAIERWVVVCKPISNFRFGENHAIMGLTLTWVMANACAMPPLFGWSRYIP EGLQCSCGIDYYTLKPEVNNESFVIYMFLVHFTIPLTIISFCYGRLVCAVKEAAAQQQES ETTQRAEREVTRMVVIMVISFLVCWIPYASVAWYIFTHQGSTFGPIFMTVPSFFAKSSSI YNPMIYICMNKQFRNCMITTLFCGKNPFEGEEEGSTTKTEASAVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S317 Recombinant Protein (Human)
RP087663 100 µg

RN5S317 Recombinant Protein (Human)

Sign In for Pricing
View Details
HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) (AP) discontinued
127703-AP 100 µL

HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) (AP) discontinued

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG (H+L)
FNSA-0031-01 100 µL

FITC-Goat Anti-Rabbit IgG (H+L)

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG (H+L)
FNSA-0031-02 500 µL

FITC-Goat Anti-Rabbit IgG (H+L)

Sign In for Pricing
View Details
Anti Arabidopsis LacI Mab [15C1]
401046 100 µg

Anti Arabidopsis LacI Mab [15C1]

Sign In for Pricing
View Details
Rat Sycp3 Pre-designed siRNA Set A
SI214050A 1 Each

Rat Sycp3 Pre-designed siRNA Set A

Sign In for Pricing
View Details