Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 185A (TMEM185A)

This Recombinant Pongo abelii Transmembrane protein 185A (TMEM185A) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185A, Protein FAM11A

UniProt

Q5R8H8

Expression Region

1-350

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASV GTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLF FVSPVSVAACVWDFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMS FLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNA FSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYALPPPKLNIEMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®740 Arachis hypogaea Lectin PNA (Peanut)
#29137 1x 1 mg

CF®740 Arachis hypogaea Lectin PNA (Peanut)

Sign In for Pricing
View Details
MPO Antibody
F42682-0.4ML 0.4 mL

MPO Antibody

Sign In for Pricing
View Details
Tyramide Amplification Kit with HRP Goat Anti-Rabbit and CF®680R Tyramide
#33016 1 Kit

Tyramide Amplification Kit with HRP Goat Anti-Rabbit and CF®680R Tyramide

Sign In for Pricing
View Details
Human Kallikrein 15 (KLK15) activation kit by CRISPRa
GA110787 1 Kit

Human Kallikrein 15 (KLK15) activation kit by CRISPRa

Sign In for Pricing
View Details
MLH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]
TA805066AM 100 µL

MLH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details
Caprylyl Peroxide
TRC-C175713-100MG 100 mg

Caprylyl Peroxide

Sign In for Pricing
View Details