Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 185A (TMEM185A)

This Recombinant Pongo abelii Transmembrane protein 185A (TMEM185A) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185A, Protein FAM11A

UniProt

Q5R8H8

Expression Region

1-350

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASV GTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLF FVSPVSVAACVWDFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMS FLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNA FSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYALPPPKLNIEMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAG5 (N-term) Goat Polyclonal Antibody
AP31064PU-N 100 µg

BAG5 (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
5-Nitro-1H-indazole-7-carboxylic Acid
TRC-N901363-500MG 500 mg

5-Nitro-1H-indazole-7-carboxylic Acid

Sign In for Pricing
View Details
PLAUR Human Gene Knockout Kit (CRISPR)
KN201222RB 1 Kit

PLAUR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zbtb24 Mouse Gene Knockout Kit (CRISPR)
KN519601 1 Kit

Zbtb24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAOX (NM_207127) Human Recombinant Protein
TP321583L 1 mg

PAOX (NM_207127) Human Recombinant Protein

Sign In for Pricing
View Details
7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid
TRC-H829190-25MG 25 mg

7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid

Sign In for Pricing
View Details