Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 185B (TMEM185B)

This Recombinant Bovine Transmembrane protein 185B (TMEM185B) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185B, Protein FAM11B

UniProt

Q08DE2

Expression Region

1-350

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGVIQWSYWAVFAPIWLWKLLVLAGASV GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMS FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAICWITIVVPLLIFEVLLVHRLDGHNM FSYISIFVPLWLSLITLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLH HEDSEDAEETSAPEAPKIAPMFGKKARVVITQSPGKYVPPPPKLNIDMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,5-Diphenyl Hydantoin Sodium
TRC-D491655-50MG 50 mg

5,5-Diphenyl Hydantoin Sodium

Sign In for Pricing
View Details
Peroxiredoxin-6 Antibody
KC-965-01 50 μL

Peroxiredoxin-6 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-6 Antibody
KC-965-02 100 µL

Peroxiredoxin-6 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-6 Antibody
KC-965-03 1 mL

Peroxiredoxin-6 Antibody

Sign In for Pricing
View Details
Alpha 2a Adrenergic Receptor Rabbit polyclonal Antibody
ER62703 100 µL

Alpha 2a Adrenergic Receptor Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Live-or-DyeTM 568/583 Fixable Viability Staining Kit (200 assays)
#32005 1 Kit

Live-or-DyeTM 568/583 Fixable Viability Staining Kit (200 assays)

Sign In for Pricing
View Details