Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 185B (Tmem185b)

This Recombinant Mouse Transmembrane protein 185B (Tmem185b) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185B, Protein FAM11B

UniProt

Q8R3R5

Expression Region

1-350

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVIVGASV GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEILVCDRVERGTHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMS FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLLIFEVLLVHRLDDHNT FSYISIFIPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEVFPFLREYGNISYDLH HEDSEDAEDASVSEAPKIAPMFGKKARVVITQSPGKYVPPPPKLNIDMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT34 (Keratin, Type I Cuticular Ha4, Hair Keratin, Type I Ha4, Keratin-34, K34, HHA4, HKA4, KRTHA4) (PE)
128950-PE 100 µL

KRT34 (Keratin, Type I Cuticular Ha4, Hair Keratin, Type I Ha4, Keratin-34, K34, HHA4, HKA4, KRTHA4) (PE)

Sign In for Pricing
View Details
Ilvbl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3174806 1.0 µg DNA

Ilvbl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ARHGEF2 Antibody
orb192614-01 50 μL

ARHGEF2 Antibody

Sign In for Pricing
View Details
ARHGEF2 Antibody
orb192614-02 100 µL

ARHGEF2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PLEKHO2 Antibody [DyLight 680]
NBP3-06325FR 0.1 mL

Rabbit Polyclonal PLEKHO2 Antibody [DyLight 680]

Sign In for Pricing
View Details
Mouse EMP2 shRNA Plasmid
abx970163-01 150 µg

Mouse EMP2 shRNA Plasmid

Sign In for Pricing
View Details