Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 185B (Tmem185b)

This Recombinant Mouse Transmembrane protein 185B (Tmem185b) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Transmembrane protein 185B, Protein FAM11B

UniProt

Q8R3R5

Expression Region

1-350

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVIVGASV GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEILVCDRVERGTHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMS FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLLIFEVLLVHRLDDHNT FSYISIFIPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEVFPFLREYGNISYDLH HEDSEDAEDASVSEAPKIAPMFGKKARVVITQSPGKYVPPPPKLNIDMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC4 Antibody (Center) Blocking Peptide
MBS9224826-01 0.5 mg

GPC4 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
GPC4 Antibody (Center) Blocking Peptide
MBS9224826-02 5x 0.5 mg

GPC4 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human Mesoderm posterior protein 1/MESP1 (C-His)
BP2571-50ug 50 µg

Recombinant Human Mesoderm posterior protein 1/MESP1 (C-His)

Sign In for Pricing
View Details
SPR2D rabbit pAb
MBS8598319-01 0.1 mL

SPR2D rabbit pAb

Sign In for Pricing
View Details
SPR2D rabbit pAb
MBS8598319-02 0.1 mL (AF405L)

SPR2D rabbit pAb

Sign In for Pricing
View Details
SPR2D rabbit pAb
MBS8598319-03 0.1 mL (AF405S)

SPR2D rabbit pAb

Sign In for Pricing
View Details