Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52I2 (OR52I2)

This Recombinant Human Olfactory receptor 52I2 (OR52I2) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Olfactory receptor 52I2, Olfactory receptor OR11-12

UniProt

Q8NH67

Expression Region

1-350

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCQQILRDCILLIHHLCINRKKVSLVMLGPAYNHTMETPASFLLVGIPGLQSSHLWLAIS LSAMYIIALLGNTIIVTAIWMDSTRHEPMYCFLCVLAAVDIVMASSVVPKMVSIFCSGDS SISFSACFTQMFFVHLATAVETGLLLTMAFDRYVAICKPLHYKRILTPQVMLGMSMAITI RAIIAITPLSWMVSHLPFCGSNVVVHSYCEHIALARLACADPVPSSLYSLIGSSLMVGSD VAFIAASYILILKAVFGLSSKTAQLKALSTCGSHVGVMALYYLPGMASIYAAWLGQDVVP LHTQVLLADLYVIIPATLNPIIYGMRTKQLRERIWSYLMHVLFDHSNLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 5 (PRDX5) Mouse Monoclonal Antibody [Clone ID: OTI3B6]
CF811474 100 µg

Peroxiredoxin 5 (PRDX5) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF740 conjugate, 0.1mg/mL
BNC741017-100 1x 100 µL

SOX10 (SOX10/1074), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF488A conjugate, 0.1mg/mL
BNC882753-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UC-01 25 µg

FITC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UC-02 100 µg

FITC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
RAB40A Polyclonal Antibody
E-AB-90623-01 60 µL

RAB40A Polyclonal Antibody

Sign In for Pricing
View Details