Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52I2 (OR52I2)

This Recombinant Human Olfactory receptor 52I2 (OR52I2) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Olfactory receptor 52I2, Olfactory receptor OR11-12

UniProt

Q8NH67

Expression Region

1-350

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCQQILRDCILLIHHLCINRKKVSLVMLGPAYNHTMETPASFLLVGIPGLQSSHLWLAIS LSAMYIIALLGNTIIVTAIWMDSTRHEPMYCFLCVLAAVDIVMASSVVPKMVSIFCSGDS SISFSACFTQMFFVHLATAVETGLLLTMAFDRYVAICKPLHYKRILTPQVMLGMSMAITI RAIIAITPLSWMVSHLPFCGSNVVVHSYCEHIALARLACADPVPSSLYSLIGSSLMVGSD VAFIAASYILILKAVFGLSSKTAQLKALSTCGSHVGVMALYYLPGMASIYAAWLGQDVVP LHTQVLLADLYVIIPATLNPIIYGMRTKQLRERIWSYLMHVLFDHSNLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
TA804356AM 100 µL

PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details
MBNL1 (NM_207297) Human Over-expression Lysate
LY404080 100 µg

MBNL1 (NM_207297) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
POU4F2 (NM_004575) Human Recombinant Protein
TP315962L 1 mg

POU4F2 (NM_004575) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin
ICH1044-50mg 50 mg

Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
LGALS3BP Human Gene Knockout Kit (CRISPR)
KN204918BN 1 Kit

LGALS3BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details