Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein 185B (TMEM185B)

This Recombinant Human Putative transmembrane protein 185B (TMEM185B) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Putative transmembrane protein 185B, Protein FAM11B

UniProt

Q9H7F4

Expression Region

1-350

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASV GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMS FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLLTFEVLLVHRLDGHNT FSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLH HEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD161 Antibody (B199.2) [Alexa Fluor 647]
NB100-65298AF647 0.1 mL

Mouse Monoclonal CD161 Antibody (B199.2) [Alexa Fluor 647]

Sign In for Pricing
View Details
IGFBP2 Antibody
orb619988 100 µL

IGFBP2 Antibody

Sign In for Pricing
View Details
Human TLR2 PerCP MAb (Clone 383936)
FAB2616C 100 Tests

Human TLR2 PerCP MAb (Clone 383936)

Sign In for Pricing
View Details
Rabbit Polyclonal NADK Antibody
NBP3-30328 100 µg

Rabbit Polyclonal NADK Antibody

Sign In for Pricing
View Details
PTGIS Antibody, FITC conjugated
A32387-50UG 50 µg

PTGIS Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Monoclonal MVP Antibody (1014) [DyLight 488]
NBP3-11555G 0.1 mL

Mouse Monoclonal MVP Antibody (1014) [DyLight 488]

Sign In for Pricing
View Details