Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein 185B (TMEM185B)

This Recombinant Human Putative transmembrane protein 185B (TMEM185B) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Putative transmembrane protein 185B, Protein FAM11B

UniProt

Q9H7F4

Expression Region

1-350

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASV GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMS FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLLTFEVLLVHRLDGHNT FSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLH HEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EDF1 Antibody
NBP1-84011 0.1 mL

Rabbit Polyclonal EDF1 Antibody

Sign In for Pricing
View Details
MTHFD1L Rabbit pAb, IRDye 800CW conjugated
orb2852510 100 µL

MTHFD1L Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
ssaA1 Antibody
A56717-50UG 50 µg

ssaA1 Antibody

Sign In for Pricing
View Details
Sertad1 3'UTR Lenti-reporter-Luc Vector
43509086 1.0 µg

Sertad1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rad51d (NM_001107029) Rat Tagged ORF Clone Lentiviral Particle
RR202731L4V 200 µL

Rad51d (NM_001107029) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PDHA2 polyclonal antibody
orb1721292-01 50 µL

PDHA2 polyclonal antibody

Sign In for Pricing
View Details