Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein 185B (TMEM185B)

This Recombinant Human Putative transmembrane protein 185B (TMEM185B) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Putative transmembrane protein 185B, Protein FAM11B

UniProt

Q9H7F4

Expression Region

1-350

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASV GAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMS FLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLLTFEVLLVHRLDGHNT FSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLH HEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAAM2 Polyclonal Antibody
30933-01 50 µL

DAAM2 Polyclonal Antibody

Sign In for Pricing
View Details
DAAM2 Polyclonal Antibody
30933-02 100 µL

DAAM2 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638441 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
7502 Half Mask - Medium
SAF8441 1 Each

7502 Half Mask - Medium

Sign In for Pricing
View Details
Lentiviral human CD7 sgRNA gene knockout kit - Lentiviral human CD7 sgRNA gene knockout kit (100)
GTR15387754 1 Vial

Lentiviral human CD7 sgRNA gene knockout kit - Lentiviral human CD7 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral mouse 4933402N22Rik shRNA (UAS) - Lentiviral mouse 4933402N22Rik shRNA (UAS, iRFP) (100)
GTR15128319 1 Vial

Lentiviral mouse 4933402N22Rik shRNA (UAS) - Lentiviral mouse 4933402N22Rik shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details