Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix jacchus Opsin, longwave 563 nm

This Recombinant Callithrix jacchus Opsin, longwave 563 nm spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Opsin, longwave 563 nm

UniProt

P34989

Expression Region

1-350

Origin

Callithrix jacchus (White-tufted-ear marmoset)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HRLAGRHPQDNYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMLFVVVAS VFTNGLVLAATMKFKKLRHPLNWILVNLAIADLAETVIASTISVVNQVHGYFVLGHPMCV LEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIVGVAFSWIWSAVWTAPP IFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCFLPLGIIVLCYLQVWLAIR AVAKQQKESESTQKAEKEVTRMVVVMIVAYCVCWGPYTFFACFAAANPGYAFHPLMAALP AYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP4A Antibody Blocking peptide
orb1460639 500 µg

INPP4A Antibody Blocking peptide

Sign In for Pricing
View Details
EGF Polyclonal Antibody
E-AB-10297-01 20 µL

EGF Polyclonal Antibody

Sign In for Pricing
View Details
EGF Polyclonal Antibody
E-AB-10297-02 60 µL

EGF Polyclonal Antibody

Sign In for Pricing
View Details
EGF Polyclonal Antibody
E-AB-10297-03 120 µL

EGF Polyclonal Antibody

Sign In for Pricing
View Details
EGF Polyclonal Antibody
E-AB-10297-04 200 µL

EGF Polyclonal Antibody

Sign In for Pricing
View Details
AKAP1 (NM_003488) Human Over-expression Lysate
LS008165 100 µg

AKAP1 (NM_003488) Human Over-expression Lysate

Sign In for Pricing
View Details