Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix jacchus Opsin, longwave 563 nm

This Recombinant Callithrix jacchus Opsin, longwave 563 nm spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Opsin, longwave 563 nm

UniProt

P34989

Expression Region

1-350

Origin

Callithrix jacchus (White-tufted-ear marmoset)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HRLAGRHPQDNYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMLFVVVAS VFTNGLVLAATMKFKKLRHPLNWILVNLAIADLAETVIASTISVVNQVHGYFVLGHPMCV LEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIVGVAFSWIWSAVWTAPP IFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCFLPLGIIVLCYLQVWLAIR AVAKQQKESESTQKAEKEVTRMVVVMIVAYCVCWGPYTFFACFAAANPGYAFHPLMAALP AYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NBN (Ser343) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6125R-BF680 100 µL

Phospho-NBN (Ser343) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Zfp648 shRNA (UAS) - Lentiviral mouse Zfp648 shRNA (UAS, RFP) (25)
GTR15246047 1 Vial

Lentiviral mouse Zfp648 shRNA (UAS) - Lentiviral mouse Zfp648 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
HA Antibody
OAPA00111-100UL 100 µL

HA Antibody

Sign In for Pricing
View Details
SYN1-RFP (Bsd) Lentivirus in PBS
LVP1030-B-PBS 1x 10^8 IFU/mL - 200 μL

SYN1-RFP (Bsd) Lentivirus in PBS

Sign In for Pricing
View Details
Rat Coagulation Factor II ELISA Kit
MBS3809004-01 48 Well

Rat Coagulation Factor II ELISA Kit

Sign In for Pricing
View Details
Rat Coagulation Factor II ELISA Kit
MBS3809004-02 96 Well

Rat Coagulation Factor II ELISA Kit

Sign In for Pricing
View Details