Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Pinopsin

This Recombinant Chicken Pinopsin spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Pinopsin, Pineal gland-specific opsin, P-opsin, Pineal opsin

UniProt

P51475

Expression Region

1-351

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSNSSQAPPNGTPGPFDGPQWPYQAPQSTYVGVAVLMGTVVACASVVNGLVIVVSICYK KLRSPLNYILVNLAVADLLVTLCGSSVSLSNNINGFFVFGRRMCELEGFMVSLTGIVGLW SLAILALERYVVVCKPLGDFQFQRRHAVSGCAFTWGWALLWSAPPLLGWSSYVPEGLRTS CGPNWYTGGSNNNSYILSLFVTCFVLPLSLILFSYTNLLLTLRAAAAQQKEADTTQRAER EVTRMVIVMVMAFLLCWLPYSTFALVVATHKGIIIQPVLASLPSYFSKTATVYNPIIYVF MNKQFQSCLLEMLCCGYQPQRTGKASPGTPGPHADVTAAGLRNKVMPAHPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRCP (N-term) Rabbit pAb
E2612332 100 µL

PRCP (N-term) Rabbit pAb

Sign In for Pricing
View Details
Transforming Growth Factor β2 (TGF-β2) Goat ELISA Kit
H7692 96 Tests

Transforming Growth Factor β2 (TGF-β2) Goat ELISA Kit

Sign In for Pricing
View Details
Recombinant Human MAPT Protein
MBS286114-01 0.1 mg

Recombinant Human MAPT Protein

Sign In for Pricing
View Details
Recombinant Human MAPT Protein
MBS286114-02 0.5 mg

Recombinant Human MAPT Protein

Sign In for Pricing
View Details
Recombinant Human MAPT Protein
MBS286114-03 1 mg

Recombinant Human MAPT Protein

Sign In for Pricing
View Details
Recombinant Human MAPT Protein
MBS286114-04 5x 1 mg

Recombinant Human MAPT Protein

Sign In for Pricing
View Details