Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aliivibrio salmonicida Electron transport complex protein RnfD (rnfD)

This Recombinant Aliivibrio salmonicida Electron transport complex protein RnfD (rnfD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfD

UniProt

B6EGH4

Expression Region

1-351

Origin

Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFFITSSPHAHSKKSTQTMMKMVALATIPGLLAQTYFFGWGTLLQVLLAIITAILAEAF VLKCRKRPLAPYLKDNSALLTGLLLALAIPPLSPWWLTVIGVFFAIVIAKHLYGGLGQNL FNPAMAAYVVLLISFPVQMTTWLPAKELLVEHISFMDSVWLIFHGLSQDGFSVHQLTMNV DGMTMATPLDTVKTGLKAGLTTNEILSAPIFNGFAGLGWLWVNVGFLLGGLFLLQQRLIH WHIPVSFLASLFIVSSLFAVFSPDTTTSPIFNLFSGATMLGAFFIATDPVSAATTNKGRL YYGALIGLLVYMIRSWGGFPDGVAFAVLLANMCVPLIDYYTKPRTYGHKKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRM1 Recombinant Rabbit Monoclonal Antibody [PSH05-41]
HA722270 100 µL

ADRM1 Recombinant Rabbit Monoclonal Antibody [PSH05-41]

Sign In for Pricing
View Details
EEF1A2 Polyclonal Antibody
E-AB-61648-01 60 µL

EEF1A2 Polyclonal Antibody

Sign In for Pricing
View Details
EEF1A2 Polyclonal Antibody
E-AB-61648-02 120 µL

EEF1A2 Polyclonal Antibody

Sign In for Pricing
View Details
EEF1A2 Polyclonal Antibody
E-AB-61648-03 200 µL

EEF1A2 Polyclonal Antibody

Sign In for Pricing
View Details
OR2W3 (NM_001001957) Human Over-expression Lysate
LY424290 100 µg

OR2W3 (NM_001001957) Human Over-expression Lysate

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL
BNC040748-500 1x 500 µL

CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details