Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Formyl peptide receptor-related sequence 1 (Fpr-s1)

This Recombinant Mouse Formyl peptide receptor-related sequence 1 (Fpr-s1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Formyl peptide receptor-related sequence 1, FMLP-related receptor I, FMLP-R-I, Formyl peptide receptor related sequence 1, Formyl peptide receptor-like 1, Lipoxin A4 receptor, Sho

UniProt

O08790

Expression Region

1-351

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METNYSIPLNGSDVVIYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIA LDRCICVLHPVWAQNHRTVSLARNVVVGSWIFALILTLPLFLFLTTVRDARGDVHCRLSF VSWGNSVEERLNTAITFVTTRGIIRFIVSFSLPMSFVAICYGLITTKIHKKAFVNSSRPF RVLTGVVASFFICWFPFQLVALLGTVWLKEMQFSGSYKIIGRLVNPTSSLAFFNSCLNPI LYVFMGQDFQERLIHSLSSRLQRALSEDSGHISDTRTNLASLPEDIEIKAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salicyloyl Phytosphingosine
TRC-S634480-25MG 25 mg

Salicyloyl Phytosphingosine

Sign In for Pricing
View Details
CD69 Mouse Monoclonal Antibody [Clone ID: FN50]
AM03132PU-N 100 µg

CD69 Mouse Monoclonal Antibody [Clone ID: FN50]

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/3140R), 0.2mg/mL
BNUB3140-500 1x 500 µL

Replication Protein A2 (RPA2) (RPA2/3140R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant NRAS Antibody
RC-4887-01 50 μL

Recombinant NRAS Antibody

Sign In for Pricing
View Details
Recombinant NRAS Antibody
RC-4887-02 100 µL

Recombinant NRAS Antibody

Sign In for Pricing
View Details
Recombinant NRAS Antibody
RC-4887-03 1 mL

Recombinant NRAS Antibody

Sign In for Pricing
View Details