Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Formyl peptide receptor-related sequence 1 (Fpr-s1)

This Recombinant Mouse Formyl peptide receptor-related sequence 1 (Fpr-s1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Formyl peptide receptor-related sequence 1, FMLP-related receptor I, FMLP-R-I, Formyl peptide receptor related sequence 1, Formyl peptide receptor-like 1, Lipoxin A4 receptor, Sho

UniProt

O08790

Expression Region

1-351

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METNYSIPLNGSDVVIYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIA LDRCICVLHPVWAQNHRTVSLARNVVVGSWIFALILTLPLFLFLTTVRDARGDVHCRLSF VSWGNSVEERLNTAITFVTTRGIIRFIVSFSLPMSFVAICYGLITTKIHKKAFVNSSRPF RVLTGVVASFFICWFPFQLVALLGTVWLKEMQFSGSYKIIGRLVNPTSSLAFFNSCLNPI LYVFMGQDFQERLIHSLSSRLQRALSEDSGHISDTRTNLASLPEDIEIKAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGC5 (Center) Rabbit Polyclonal Antibody
AP53217PU-N 400 µL

PCDHGC5 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF640R conjugate, 0.1mg/mL
BNC401948-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fmoc-Asp (t-Bu) TentaGel® R HMPA Resin
RA1505.1G 1 g

Fmoc-Asp (t-Bu) TentaGel® R HMPA Resin

Sign In for Pricing
View Details
Ifna2 Mouse Gene Knockout Kit (CRISPR)
KN308131RB 1 Kit

Ifna2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cebpa Mouse Gene Knockout Kit (CRISPR)
KN503099 1 Kit

Cebpa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Carboxypeptidase Z (CPZ) (NM_003652) Human Over-expression Lysate
LY401209 100 µg

Carboxypeptidase Z (CPZ) (NM_003652) Human Over-expression Lysate

Sign In for Pricing
View Details