Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bunopithecus hoolock C-X-C chemokine receptor type 1 (CXCR1)

This Recombinant Bunopithecus hoolock C-X-C chemokine receptor type 1 (CXCR1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD_antigen= CD181

UniProt

Q2YEG2

Expression Region

1-351

Origin

Bunopithecus hoolock (Hoolock gibbon) (Hoolock hoolock)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNITDPQGWDYDGDLYFTGMPPIDEDFSPCKLETETLNKYVVIITYALVFLLSLLGNSL VMLVILYSRVGRSVTDIYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEV NFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCVGCWGLSMILSLPFFLFRQAYH PNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLLVMLFCYGFTLHTLFKAHMGQKHR AMRVVFAVVLIFLLCWLPYNLVLFTDTLMRTQLIKESCERRKDISKALEATEILGFFHSC LNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHHVTSYTSSSVNVSSNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit
RD-TRPM6-Hu-01 96 Tests

Human Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit
RD-TRPM6-Hu-02 48 Tests

Human Transient Receptor Potential Cation Channel Subfamily M, Member 6 (TRPM6) ELISA Kit

Sign In for Pricing
View Details
HMGA2 (NM_003484) Human Over-expression Lysate
LC429148 20 µg

HMGA2 (NM_003484) Human Over-expression Lysate

Sign In for Pricing
View Details
ENTPD7 Rabbit Polyclonal Antibody
TA369208 100 µL

ENTPD7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZM 241385
TRC-Z487003-100MG 100 mg

ZM 241385

Sign In for Pricing
View Details
(4-Benzylpiperazin-1-yl)acetic Acid Ethyl Ester-d8
TRC-B286582-50MG 50 mg

(4-Benzylpiperazin-1-yl)acetic Acid Ethyl Ester-d8

Sign In for Pricing
View Details