Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bunopithecus hoolock C-X-C chemokine receptor type 1 (CXCR1)

This Recombinant Bunopithecus hoolock C-X-C chemokine receptor type 1 (CXCR1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD_antigen= CD181

UniProt

Q2YEG2

Expression Region

1-351

Origin

Bunopithecus hoolock (Hoolock gibbon) (Hoolock hoolock)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNITDPQGWDYDGDLYFTGMPPIDEDFSPCKLETETLNKYVVIITYALVFLLSLLGNSL VMLVILYSRVGRSVTDIYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEV NFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCVGCWGLSMILSLPFFLFRQAYH PNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLLVMLFCYGFTLHTLFKAHMGQKHR AMRVVFAVVLIFLLCWLPYNLVLFTDTLMRTQLIKESCERRKDISKALEATEILGFFHSC LNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHHVTSYTSSSVNVSSNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HSBP1
Y058815 100 µg

Anti-HSBP1

Sign In for Pricing
View Details
FNDC3B Rabbit Polyclonal Antibody
TA369512 100 µL

FNDC3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XPF (ERCC4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H10]
TA503324AM 100 µL

XPF (ERCC4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H10]

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS2), CF405S conjugate, 0.1mg/mL
BNC041742-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-mFC)
PKSH033849-01 10 µg

Recombinant Human Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-mFC)

Sign In for Pricing
View Details
Recombinant Human Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-mFC)
PKSH033849-02 50 µg

Recombinant Human Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-mFC)

Sign In for Pricing
View Details