Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C chemokine receptor type 1 (Cxcr1)

This Recombinant Mouse C-X-C chemokine receptor type 1 (Cxcr1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, High affinity interleukin-8 receptor A, IL-8R A, CD_antigen= CD181

UniProt

Q810W6

Expression Region

1-351

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQALVVFYALVSLLSLL GNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKGWIFGTPLCKMVSL LKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCVGIWGLSLILSLPFAIFR QAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLTMLVCYGLTLRMLFKTHMR QKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDTCERRNDIDQALYITEILGF SHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRRVAFHTSLTAIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-500 1x 500 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details