Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfD (rnfD)

This Recombinant Electron transport complex protein RnfD (rnfD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfD

UniProt

Q8ZED2

Expression Region

1-351

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIASSPFTHNQRSTRRIMLLVILACIPGIIAQTYFFGYGSLIQVMLAMITALLAEGAVL QLRKQPVMARLQDNSALLTALLLGISLPPLAPWWMIVLGTLFAIVIAKQLYGGLGQNPFN PAMVGYVVLLISFPVQMTSWLPPLPLQGTSVGFYDSLLTIFTGYTHSGENIHQLQVGYDG ISQATPLDTFKTSLRSQPADQILQQPIFGGVLAGLGWQWVNTGFLVGGLLLLWRKAIHWH IPVSFLLALGGCAAVSWMIAPQSFASPMLHLFSGATMLGAFFIATDPVSASTTPRGRLIF GALIGILVWLIRVYGGYPDSVAFAVLLANITVPLIDHYTQPRVYGHKSGHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TSH beta Antibody / TSHB
orb2635714 100 µg

Recombinant TSH beta Antibody / TSHB

Sign In for Pricing
View Details
ITK, NT (ITK, EMT, LYK, Tyrosine-protein kinase ITK/TSK, Interleukin-2-inducible T-cell kinase, Kinase EMT, T-cell-specific kinase, Tyrosine-protein kinase Lyk) (FITC)
MBS6311348-01 0.2 mL

ITK, NT (ITK, EMT, LYK, Tyrosine-protein kinase ITK/TSK, Interleukin-2-inducible T-cell kinase, Kinase EMT, T-cell-specific kinase, Tyrosine-protein kinase Lyk) (FITC)

Sign In for Pricing
View Details
ITK, NT (ITK, EMT, LYK, Tyrosine-protein kinase ITK/TSK, Interleukin-2-inducible T-cell kinase, Kinase EMT, T-cell-specific kinase, Tyrosine-protein kinase Lyk) (FITC)
MBS6311348-02 5x 0.2 mL

ITK, NT (ITK, EMT, LYK, Tyrosine-protein kinase ITK/TSK, Interleukin-2-inducible T-cell kinase, Kinase EMT, T-cell-specific kinase, Tyrosine-protein kinase Lyk) (FITC)

Sign In for Pricing
View Details
Olfr1013 Recombinant Protein (Mouse)
RP155936 100 µg

Olfr1013 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Enterobacter aerogenes Glycerol dehydrogenase, conjugated with Biotin Antibody
orb20980 1 mL

Rabbit Enterobacter aerogenes Glycerol dehydrogenase, conjugated with Biotin Antibody

Sign In for Pricing
View Details
MLLT6 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila) ; Translocated to, 6, AF17, FLJ23480) (MaxLight 490)
248799-ML490 100 µL

MLLT6 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila) ; Translocated to, 6, AF17, FLJ23480) (MaxLight 490)

Sign In for Pricing
View Details