Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Blue-sensitive opsin

This Recombinant Carassius auratus Blue-sensitive opsin spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

P32310

Expression Region

1-351

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQVPEFHEDFYIPIPLDINNLSAYSPFLVPQDHLGNQGIFMAMSVFMFFIFIGGASINI LTILCTIQFKKLRSHLNYILVNLSIANLFVAIFGSPLSFYSFFNRYFIFGATACKIEGFL ATLGGMVGLWSLAVVAFERWLVICKPLGNFTFKTPHAIAGCILPWISALAASLPPLFGWS RYIPEGLQCSCGPDWYTTNNKYNNESYVMFLFCFCFAVPFGTIVFCYGQLLITLKLAAKA QADSASTQKAEREVTKMVVVMVLGFLVCWAPYASFSLWIVSHRGEEFDLRMATIPSCLSK ASTVYNPVIYVLMNKQFRSCMMKMVCGKNIEEDEASTSSQVTQVSSVAPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human adenovirus C serotype 2 Early E3B 14.5 kDa protein, partial
MBS7062926 Inquire

Recombinant Human adenovirus C serotype 2 Early E3B 14.5 kDa protein, partial

Sign In for Pricing
View Details
Rasd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3477607 1.0 µg DNA

Rasd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PARP (Poly ADP-Ribose Polymerase) (BSA & Azide Free) (AP) discontinued
P3113-06AX-AP 100 µL

PARP (Poly ADP-Ribose Polymerase) (BSA & Azide Free) (AP) discontinued

Sign In for Pricing
View Details
Cdx1 Double Nickase Plasmid (m2)
sc-419617-NIC-2 20 µg

Cdx1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Nup93 Double Nickase Plasmid (m)
sc-428075-NIC 20 µg

Nup93 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
P2Y6 Rabbit pAb
E2382646 100 µL

P2Y6 Rabbit pAb

Sign In for Pricing
View Details