Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Blue-sensitive opsin

This Recombinant Carassius auratus Blue-sensitive opsin spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

P32310

Expression Region

1-351

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQVPEFHEDFYIPIPLDINNLSAYSPFLVPQDHLGNQGIFMAMSVFMFFIFIGGASINI LTILCTIQFKKLRSHLNYILVNLSIANLFVAIFGSPLSFYSFFNRYFIFGATACKIEGFL ATLGGMVGLWSLAVVAFERWLVICKPLGNFTFKTPHAIAGCILPWISALAASLPPLFGWS RYIPEGLQCSCGPDWYTTNNKYNNESYVMFLFCFCFAVPFGTIVFCYGQLLITLKLAAKA QADSASTQKAEREVTKMVVVMVLGFLVCWAPYASFSLWIVSHRGEEFDLRMATIPSCLSK ASTVYNPVIYVLMNKQFRSCMMKMVCGKNIEEDEASTSSQVTQVSSVAPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP19 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62502R-BF405-TR 20 µL

SRP19 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
MRPL9 Recombinant Protein Antigen
NBP1-89561PEP 0.1 mL

MRPL9 Recombinant Protein Antigen

Sign In for Pricing
View Details
CWC15 (h) : 293T Lysate
sc-115798 100 µg - 200 µL

CWC15 (h) : 293T Lysate

Sign In for Pricing
View Details
Human Artemin (ARTN) ELISA Kit
RDR-ARTN-Hu-48Tests 48 Tests

Human Artemin (ARTN) ELISA Kit

Sign In for Pricing
View Details
Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone Lentiviral Particle
RC211955L3V 200 µL

Manic Fringe (MFNG) (NM_002405) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dystrophin (DMD) APC
MBS6136337-01 0.1 mL

Dystrophin (DMD) APC

Sign In for Pricing
View Details