Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cysteinyl leukotriene receptor 1 (Cysltr1)

This Recombinant Mouse Cysteinyl leukotriene receptor 1 (Cysltr1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Cysteinyl leukotriene receptor 1, CysLTR1, Cysteinyl leukotriene D4 receptor, LTD4 receptor

UniProt

Q99JA4

Expression Region

1-352

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVL YVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYV NLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQ DEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNM PSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAA SNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-100 1x 100 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF405S conjugate, 0.1mg/mL
BNC042171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-500 1x 500 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details