Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tupaia minor B1 bradykinin receptor (BDKRB1)

This Recombinant Tupaia minor B1 bradykinin receptor (BDKRB1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

B1 bradykinin receptor, B1R, BK-1 receptor

UniProt

Q8HZP1

Expression Region

1-352

Origin

Tupaia minor (Lesser tree shrew)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQTLLELQPSNQSQLSALNTTSCDNAREAWDLLYQVLPIFILTICAFGLLGNLFVLSV FLLLRRRLTVAEIYLVNLAASDLVFVLGLPFWAQNIWNQFNWPFGDLLCRVVNGVIKANL FISIFLMVAISQDRYCVLVHPMASRRRRRRRRARATCMVIWAVGALLSTPTFLLRSVSAV QDLNISACILLLPHQAWHVARIVELNVLGFLLPLAAIIFFNGHILASLRGQGEVSQTRIG GPKDCKTTVLILTLVAAFLVCWAPYHCFAFLEFLFQVRAVRGCFWEDFIDLGLQLANFFA FTNSCLNPVIYVFVGRLFRTKVWELYQQCTPRRPAPLSSSRRKEILRRFWRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF640R conjugate, 0.1mg/mL
BNC402151-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details