Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus pygerythrus B1 bradykinin receptor (BDKRB1)

This Recombinant Cercopithecus pygerythrus B1 bradykinin receptor (BDKRB1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

B1 bradykinin receptor, B1R, BK-1 receptor

UniProt

Q8HZP3

Expression Region

1-352

Origin

Cercopithecus pygerythrus (Vervet monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICSFGLLGNLFVLLV FLLPRRRLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRGINGVIKANL FISIFLVVAISQDRYCLLVHPMASRRRQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAV PDLNITACILLLPHEAWHFARIVELNILAFLLPLAAIVFFNYHILASLRGREEVSRTRCG GRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAIRSCFWEDFIDLGLQLANFLA FTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Arylsulfatase B ELISA Kit
MBS069146-01 48 Well

Sheep Arylsulfatase B ELISA Kit

Sign In for Pricing
View Details
Sheep Arylsulfatase B ELISA Kit
MBS069146-02 96 Well

Sheep Arylsulfatase B ELISA Kit

Sign In for Pricing
View Details
Sheep Arylsulfatase B ELISA Kit
MBS069146-03 5x 96 Well

Sheep Arylsulfatase B ELISA Kit

Sign In for Pricing
View Details
Sheep Arylsulfatase B ELISA Kit
MBS069146-04 10x 96 Well

Sheep Arylsulfatase B ELISA Kit

Sign In for Pricing
View Details
Human GTP-binding protein Di-Ras1 (DIRAS1) ELISA Kit
orb1669998-01 48 Tests

Human GTP-binding protein Di-Ras1 (DIRAS1) ELISA Kit

Sign In for Pricing
View Details
Human GTP-binding protein Di-Ras1 (DIRAS1) ELISA Kit
orb1669998-02 96 Tests

Human GTP-binding protein Di-Ras1 (DIRAS1) ELISA Kit

Sign In for Pricing
View Details