Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus pygerythrus B1 bradykinin receptor (BDKRB1)

This Recombinant Cercopithecus pygerythrus B1 bradykinin receptor (BDKRB1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

B1 bradykinin receptor, B1R, BK-1 receptor

UniProt

Q8HZP3

Expression Region

1-352

Origin

Cercopithecus pygerythrus (Vervet monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICSFGLLGNLFVLLV FLLPRRRLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRGINGVIKANL FISIFLVVAISQDRYCLLVHPMASRRRQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAV PDLNITACILLLPHEAWHFARIVELNILAFLLPLAAIVFFNYHILASLRGREEVSRTRCG GRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAIRSCFWEDFIDLGLQLANFLA FTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLG (Plasminogen, DKFZp779M0222) (MaxLight 750) discontinued
131470-ML750 100 µL

PLG (Plasminogen, DKFZp779M0222) (MaxLight 750) discontinued

Sign In for Pricing
View Details
FRMD5 Antibody, HRP conjugated
MBS7044980-01 0.05 mg

FRMD5 Antibody, HRP conjugated

Sign In for Pricing
View Details
FRMD5 Antibody, HRP conjugated
MBS7044980-02 0.1 mg

FRMD5 Antibody, HRP conjugated

Sign In for Pricing
View Details
FRMD5 Antibody, HRP conjugated
MBS7044980-03 5x 0.1 mg

FRMD5 Antibody, HRP conjugated

Sign In for Pricing
View Details
Protease and Phosphatase Inhibitor Cocktail (EDTA Free, 100X in ddH2O)
K4006-1 1 mL

Protease and Phosphatase Inhibitor Cocktail (EDTA Free, 100X in ddH2O)

Sign In for Pricing
View Details
BRD4 Rabbit Polyclonal Antibody (Fluoro594)
orb3119965 100 µg

BRD4 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details